MST1 Monoclonal antibody proteintech 66663-1-Ig
$449.00
In stock
SKU
66663-1-Ig
MST2, STK4, STK4/MST1, 2G11C1, EC:2.7.11.1
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag17738 Product name: Recombinant human STK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 383-451 aa of BC093768 Sequence: RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 487 aa, 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC093768 |
| Conjugate: Unconjugated | Gene Symbol: MST1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6789 |
| Application: Western Blot (WB) | RRID: AB_2882018 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Mammalian STE20-like serine-threonine kinase MST1, encoded by the STK4 gene, is a multifunctional protein. MST1 and its closest paralogs MST2 (encoded by the STK3 gene), MST3, and MST4 are members of the Class II Germinal Center Family of Protein Kinases . STK3/4 and LATS1/2 (large tumor suppressor 1 and 2) are core kinase components of the Hippo tumor suppressor pathway in mammalians . In the conventional Hippo pathway, the STK3/4 and LATS1/2 signaling cascade phosphorylates and inactivates the transcriptional coactivator YAP1 (yes associated protein 1) and its close paralog WWTR1]. YAP1 and WWTR1 do not have DNA binding domains and they exert their biological outputs, such as cell proliferation and survival, by interacting with the TEAD1-4 transcription factors. Lines of evidence have indicated that dysregulation or loss of STK4/Hippo signaling is linked to developmental disorders and carcinogenesis with poor prognosis. STK4 is a stress-induced kinase and it can be activated in response to cell-death inducers. Autophosphorylation of STK4 at Thr183 (Thr180 in STK3) in the activation loop is a key activation mechanism for STK4/3 because phosphorylation of Thr183/180 causes the cleavage of STK4 by caspases under apoptotic conditions. The caspase-cleavage results in a more active STK4 protein (STK4-N, an amino-terminally truncated STK4), which localizes into the nucleus and induces apoptosis through histone modifications and chromatin condensations. |