ID1 Monoclonal antibody proteintech 67827-1-Ig
$449.00
In stock
SKU
67827-1-Ig
1H3G11, bHLHb24, Class B basic helix-loop-helix protein 24, DNA-binding protein inhibitor ID-1, ID
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag13359 Product name: Recombinant human ID1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC000613 Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000613 |
| Conjugate: Unconjugated | Gene Symbol: ID1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3397 |
| Application: Western Blot (WB) | RRID: AB_2918589 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: ID (inhibitor of DNA binding) proteins contain a helix-loop-helix (HLH) motif and regulate tissue-specific transcription within several cell lineages. They do not bind DNA directly, but inhibit lineage commitment by binding basic helix-loop-helix (bHLH) transcription factors through their HLH motif. ID1 proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID proteins contribute to cell growth, senescence, differentiation, and angiogenesis. Inhibitor of differentiation or DNA binding-1 (ID1) interacts with the transactivation domain of p65 (p65TAD) both in vitro and in vivo. The molecular weight of ID1 is about 18 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
