GMF Beta Monoclonal antibody proteintech 60062-1-Ig
$449.00
In stock
SKU
60062-1-Ig
glia maturation factor beta, GMF Beta, GMFB, GMF-beta
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, pig and More (1) | Immunogen: CatNo: Ag1104 Product name: Recombinant human GMFB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC005359 Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005359 |
| Conjugate: Unconjugated | Gene Symbol: GMFB |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2764 |
| Application: Western Blot (WB) | RRID: AB_2110835 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: human, pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon. |
Reviews
Write Your Own Review