FABP5 Monoclonal antibody proteintech 66299-1-Ig

$449.00
In stock
SKU
66299-1-Ig

 

1C6E12, EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5

Host / Isotype: Mouse / IgG1 Class: Monoclonal
Reactivity: human, mouse, rat Immunogen: CatNo: Ag3005 Product name: Recombinant human FABP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC019385 Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Predict reactive species
 Applications: WB, IHC, IF/ICC, ELISA Observed Molecular Weight: 135 aa, 15 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC019385
Conjugate: Unconjugated Gene Symbol: FABP5
Tested Applications: Positive WB detected in Gene ID (NCBI): 2171
Application: Western Blot (WB) RRID: AB_2881682
Dilution: WB : 1:2000-1:16000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Mouse / IgG1 Background Information: FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232)

 

 

Reviews

Write Your Own Review
You're reviewing:FABP5 Monoclonal antibody proteintech 66299-1-Ig
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.