TMEM111 Monoclonal antibody proteintech 67205-1-Ig
$449.00
In stock
SKU
67205-1-Ig
EMC3, 2F8G5, POB
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag18365 Product name: Recombinant human TMEM111 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 261 aa, 30 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022807 |
| Conjugate: Unconjugated | Gene Symbol: TMEM111 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 55831 |
| Application: Western Blot (WB) | RRID: AB_2882498 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
