Granzyme K Monoclonal antibody proteintech 67272-1-Ig
$449.00
In stock
SKU
67272-1-Ig
GZMK, 1C3A4, EC:3.4.21.-, Fragmentin 3, Fragmentin-3
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag27297 Product name: Recombinant human GZMK protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 85-215 aa of BC035802 Sequence: HSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSG Predict reactive species |
| Applications: IHC, IF-P, ELISA | Observed Molecular Weight: 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: GZMK |
| Conjugate: Unconjugated | Gene Symbol: 3003 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2882541 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2b | Background Information: Granzymes are a family of serine proteases stored in granules inside cytotoxic cells of the immune system. There are five human granzymes (granzyme A (GrA), GrB, GrH, GrK and GrM) currently identified, whereas mice have ten known granzymes (GrA-G, GrK, GrM and GrN) (PMID:14499263). Human GrK was first discovered in 1988 after purification from human peripheral blood mononuclear cells. GrK is expressed by cytotoxic T lymphocytes, natural killer T cells (NKT), γδ T cells and CD56bright+ NK cells. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
