CD63 Polyclonal antibody proteintech 25682-1-AP
$449.00
In stock
SKU
25682-1-AP
CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3, Lysosome integral membrane protein 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (7) | Immunogen: CatNo: Ag19690 Product name: Recombinant human CD63 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 104-209 aa of BC002349 Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IP, ChIP, ELISA | Observed Molecular Weight: 26 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002349 |
| Conjugate: Unconjugated | Gene Symbol: CD63 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 967 |
| Application: Western Blot (WB) | RRID: AB_2783831 |
| Dilution: WB : 1:500-1:40000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that play a role in the regulation of cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
