CYR61/CCN1 Monoclonal antibody proteintech 67656-1-Ig
$449.00
In stock
SKU
67656-1-Ig
CYR61, 2E11F11, CCN family member 1, CCN1, Cellular communication network factor 1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001271 |
| Conjugate: Unconjugated | Gene Symbol: CYR61 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3491 |
| Application: Western Blot (WB) | RRID: AB_2882854 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
