SDC2 Monoclonal antibody proteintech 67088-1-Ig
$449.00
In stock
SKU
67088-1-Ig
Fibroglycan, HSPG, HSPG1, SDC2, SYND2, syndecan 2
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag5739 Product name: Recombinant human SDC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 20-148 aa of BC049836 Sequence: SRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAA Predict reactive species |
| Applications: WB, IF, IHC, ELISA | Observed Molecular Weight: 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC049836 |
| Conjugate: Unconjugated | Gene Symbol: SDC2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6383 |
| Application: Western Blot (WB) | RRID: AB_2882395 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: SDC2, containing cell surface heparan sulphate proteoglycan, functions as an integral membrane protein and participates in cell proliferation, cell migration, cell adhesion and signal transduction. It has been reported that the expression level of SDC2 will be up-regulated under hypoxia condition which can induce increased release of cytokines and chemokines. Besides, methylated SDC2 can be used as a potential biomarker for early diagnosis of colon cancer. 67088-1-Ig antibody detects the 19 and 22 kDa SDC2 isoforms as well as the 48 kDa dimeric protein in SDS-PAGE.(PMID: 18803305, 23297089, 30022330, 29945573) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
