S100A11 Monoclonal antibody proteintech 60024-1-Ig
$449.00
In stock
SKU
60024-1-Ig
Calgizzarin, MLN 70, MLN70, Protein S100 A11, Protein S100 C, S100A11, S100C
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3-105 aa of BC001410 Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 105 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001410 |
| Conjugate: Unconjugated | Gene Symbol: S100A11 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6282 |
| Application: Western Blot (WB) | RRID: AB_2238821 |
| Dilution: WB : 1:1000-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: S100A11, also named as MLN 70, Calgizzarin and S100C, belongs to the S-100 family. It facilitates the differentiation and the cornification of keratinocytes. The naming of S100A11 systematically arises from its membership of the S100 protein family, named after their solubility in 100% saturated ammonium sulfate solution. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
