CD74 Monoclonal antibody proteintech 66390-1-Ig
$449.00
In stock
SKU
66390-1-Ig
Ia antigen-associated invariant chain, HLA-DR antigens-associated invariant chain, HLADG, DHLAG, Class-II-associated invariant chain peptide
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 34 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018726 |
| Conjugate: Unconjugated | Gene Symbol: CD74 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 972 |
| Application: Western Blot (WB) | RRID: AB_2881766 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
