TMEM106B (1-46aa) Monoclonal antibody proteintech 60333-1-Ig
$449.00
In stock
SKU
60333-1-Ig
TMEM106B, 5D1F8, Transmembrane protein 106B
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag21448 Product name: Recombinant human TMEM106B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC033901 Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS Predict reactive species |
| Applications: WB, IF, IP, ELISA | Observed Molecular Weight: 31 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC033901 |
| Conjugate: Unconjugated | Gene Symbol: TMEM106B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 54664 |
| Application: Western Blot (WB) | RRID: AB_2881442 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. |
Reviews
Write Your Own Review