PTGES3 Monoclonal antibody proteintech 67736-1-Ig
$449.00
In stock
SKU
67736-1-Ig
3C11D11, cPGES, EC:5.3.99.3, Hsp90 co chaperone, Hsp90 co-chaperone
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag7870 Product name: Recombinant human PTGES3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-160 aa of BC003005 Sequence: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 19 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003005 |
| Conjugate: Unconjugated | Gene Symbol: PTGES3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10728 |
| Application: Western Blot (WB) | RRID: AB_2918505 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: P23, encoded by the gene PTGES3, plays a key role in glucocorticoid signaling and was increased at the mRNA level in the DLPFC in individuals with schizophrenia (PMID: 24345775). In the GR heterocomplex in vitro, p23 is an obligatory co-factor19 and is the limiting component of the complex44, functioning to stabilize the interaction of the complex with GR in the cytoplasm. Paradoxically, p23 also acts in the nucleus to inhibit GR-mediated gene transcription and disassemble GR transcriptional machinery in the nucleus (PMID: 12077419). In vivo, p23 is critical for appropriate glucocorticoid responsiveness (PMID: 17000766). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
