NOX2 Polyclonal antibody proteintech 19013-1-AP
$449.00
In stock
SKU
19013-1-AP
CYBB, CGD, CGD91-phox, Cytochrome b-245 heavy chain, EC:1.-.-.-
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag5536 Product name: Recombinant human CYBB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 418-570 aa of BC032720 Sequence: SILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, FC (Intra), CoIP, ELISA | Observed Molecular Weight: 577 aa, 65 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032720 |
| Conjugate: Unconjugated | Gene Symbol: NOX2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1536 |
| Application: Western Blot (WB) | RRID: AB_2833044 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: NOX2, also named as CYBB, CGD, 91-phox, gp91-1, gp91-phox, p22 phagocyte B-cytochrome, cytochrome b-245 and beta polypeptide, is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. This full length protein has three glycosylation sites. CYBB is found in human cardiomyocytes as multiple bands:the signal between 55 and 65 kDa is probably the unglycosylated protein, because the predicted molecular weight of unglycosylated CYBB protein is approximately 58 kDa(PMID: 17587483) to 65 kDa in phagocytes and the bands around 80 kDa probably represent glycosylated CYBB, as has also been shown in human umbilical vein endothelial cells(PMID:12610097). In other reports, it also can be detected a band of 91 kDa(PMID:19965781). |
Reviews
Write Your Own Review