S100A8 Monoclonal antibody proteintech 66853-1-Ig
$449.00
In stock
SKU
66853-1-Ig
CFAG, Calprotectin L1L subunit, Calgranulin-A, Calgranulin A, CAGA
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag8517 Product name: Recombinant human S100A8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 93 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: S100A8 |
| Conjugate: Unconjugated | Gene Symbol: 6279 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2882193 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:250-1:1000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2a | Background Information: S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
