CHCHD2 Monoclonal antibody proteintech 66302-1-Ig
$449.00
In stock
SKU
66302-1-Ig
2G1G10, AAG10, Aging-associated gene 10 protein, C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat, Pig And More (1) | Immunogen: CatNo: Ag24219 Product name: Recombinant human CHCHD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 151 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003079 |
| Conjugate: Unconjugated | Gene Symbol: CHCHD2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 51142 |
| Application: Western Blot (WB) | RRID: AB_2881685 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
