FFAR3 Monoclonal antibody proteintech 66811-1-Ig
$449.00
In stock
SKU
66811-1-Ig
GPR41, 1D10B7, FFA3R, free fatty acid receptor 3, G protein coupled receptor 41
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag28025 Product name: Recombinant human FFAR3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 246-346 aa of BC035657 Sequence: VVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC035657 |
| Conjugate: Unconjugated | Gene Symbol: FFAR3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2865 |
| Application: Western Blot (WB) | RRID: AB_2882154 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: FFAR3 (Free fatty acid receptors 3) also known as GPR41, with another GPR43 protein, both are Gai-coupled receptor activated by short-chain fatty acids (SCFAs) such as acetate, propionate, and butyrate (PMID:26870043). GPR41 protein is translated from the bicistronic mRNA encoding?GPR40 and?GPR41, where an internal ribosome entry site (IRES) is utilized for the?GPR41?coding sequence downstream of?GPR40 (PMID:22493486). GPR41 is expressed in adipose tissue, gut, and the peripheral nervous system, and it is involved in SCFA-dependent energy regulation(PMID:?24904531). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
