RAF1 Monoclonal antibody proteintech 66592-1-Ig
$449.00
In stock
SKU
66592-1-Ig
Proto oncogene c RAF, NS5, EC:2.7.11.1, CRAF, c Raf
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 648 aa, 73 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018119 |
| Conjugate: Unconjugated | Gene Symbol: RAF1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5894 |
| Application: Western Blot (WB) | RRID: AB_2881952 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Raf-1 proto-oncogene, serine/threonine kinase(RAF1),?is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
