P27; KIP1 Polyclonal antibody proteintech 25614-1-AP
$449.00
In stock
SKU
25614-1-AP
CDKN1B, P27, MEN1B, KIP1, Cyclin-dependent kinase inhibitor p27
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (4) | Immunogen: CatNo: Ag22582 Product name: Recombinant human P27; KIP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 44-198 aa of BC001971 Sequence: DLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDGSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 198 aa, 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001971 |
| Conjugate: Unconjugated | Gene Symbol: p27 Kip1/CDKN1B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1027 |
| Application: Western Blot (WB) | RRID: AB_2880161 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CDKN1B, also named as P27 or KIP1, is a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. P27 binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controlling cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Downregulation of P27 has been implicated in the progression of several malignancies, including lung cancer, hepatocellular carcinoma, salivary cancer, oral squamous cell carcinomas, and gastric cancer. |
Reviews
Write Your Own Review