S100B Monoclonal antibody proteintech 66616-1-Ig
$449.00
In stock
SKU
66616-1-Ig
S100 beta, 1G10F4, Protein S100 B, Protein S100-B, S100 calcium-binding protein B
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, rat | Immunogen: CatNo: Ag7440 Product name: Recombinant human S100B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC001766 Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001766 |
| Conjugate: Unconjugated | Gene Symbol: S100 Beta |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6285 |
| Application: Western Blot (WB) | RRID: AB_2881976 |
| Dilution: WB : 1:1000-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: S100B is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs and has been implicated in the regulation of cellular activities such as metabolism, motility and proliferation. In the nervous system, S100B is constitutively released by astrocytes into the extracellular space and at nanomolar concentrations, it can promote neurite outgrowth and protect neurons against oxidative stress. Within the central nervous system (CNS), S100B is thought to be a marker for astroglial activation, linking astrocyte dysfunction to schizophrenia. In addition to astrocytes, S100B is released from many cell types, such as, adipocytes, chondrocytes, cardiomyocytes and lymphocytes. Serum S100B represents a new biomarker for mood disorders. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
