MRP1 Monoclonal antibody proteintech 67228-1-Ig
$449.00
In stock
SKU
67228-1-Ig
ABCC1, 1G4A2, MRP1/ABCC1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag27048 Product name: Recombinant human ABCC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 918-1025 aa of NM_004996 Sequence: SSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKLSVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGALGIS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 172 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_004996 |
| Conjugate: Unconjugated | Gene Symbol: MRP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4363 |
| Application: Western Blot (WB) | RRID: AB_2882516 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Multidrug resistant-associated protein 1 (MRP1; ABCC1) is a member of the ATP-binding cassette (ABC) transporter protein superfamily, subfamily C. MRP1 is overexpressed in cancers and contributes to the occurrence of multidrug resistance (MDR). Expression of MRP1 has been considered as a negative marker for the outcome of chemotherapy. Recently MRP1 has been reported to play a crucial role in Aβ clearance at the blood-brain barrier. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
