Osteocalcin/OCN Polyclonal antibody proteintech 23418-1-AP
$449.00
In stock
SKU
23418-1-AP
BGLAP, Osteocalcin, BGP, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag20065 Product name: Recombinant human Osteocalcin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-100 aa of BC113432 Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Predict reactive species |
| Applications: IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 100 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: Osteocalcin |
| Conjugate: Unconjugated | Gene Symbol: 632 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2879275 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:50-1:500 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse, Rat | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Osteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation. |
Reviews
Write Your Own Review