OPA1 Monoclonal antibody proteintech 66583-1-Ig
$449.00
In stock
SKU
66583-1-Ig
KIAA0567, largeG, MGM1, NTG, OPA1, Optic atrophy protein 1
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Pig, Rat And More (2) | Immunogen: CatNo: Ag26868 Product name: Recombinant human OPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 650-780 aa of BC075805 Sequence: NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 960 aa, 112 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC075805 |
| Conjugate: Unconjugated | Gene Symbol: OPA1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4976 |
| Application: Western Blot (WB) | RRID: AB_2881943 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Pig, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: OPA1 is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. OPA1 localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. OPA1 is associated with the inner membrane and protects cells from apoptosis by regulating inner membrane dynamics. Mutation of OPA1 causes the disease dominant optic atrophy, a degeneration of the retinal ganglion cells. OPA1 undergoes complex posttranscriptional regulation and posttranslational proteolysis. OPA1 is regulated by proteolytic cleavage, which degrades long OPA1 isoforms into short isoforms. The gene OPA1 can be cleaved into some chains with MW 100 kDa and 80-90 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
