CD133 Polyclonal antibody proteintech 18470-1-AP
$449.00
In stock
SKU
18470-1-AP
AC133, Antigen AC133, CORD12, MCDR2, MSTP061
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag13328 Product name: Recombinant human CD133 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 806-856 aa of BC012089 Sequence: LAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 97 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012089 |
| Conjugate: Unconjugated | Gene Symbol: CD133 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8842 |
| Application: Western Blot (WB) | RRID: AB_2172859 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. |
Reviews
Write Your Own Review