Cytokeratin 14 Monoclonal antibody proteintech 60320-1-Ig
$449.00
In stock
SKU
60320-1-Ig
KRT14, 2G1E2, CK 14, CK14, CK-14
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 472 aa, 52 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002690 |
| Conjugate: Unconjugated | Gene Symbol: Cytokeratin 14 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3861 |
| Application: Western Blot (WB) | RRID: AB_2881431 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
