TIM3 Monoclonal antibody proteintech 60355-1-Ig
$449.00
In stock
SKU
60355-1-Ig
4C4G3, CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag16901 Product name: Recombinant human HAVCR2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-142 aa of BC020843 Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE Predict reactive species |
| Applications: WB, IF, ELISA | Observed Molecular Weight: 301 aa, 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020843 |
| Conjugate: Unconjugated | Gene Symbol: TIM3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 84868 |
| Application: Western Blot (WB) | RRID: AB_2881464 |
| Dilution: WB : 1:1000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa detected by this monoclonal antibody probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
