FIS1 Monoclonal antibody proteintech 66635-1-Ig
$449.00
In stock
SKU
66635-1-Ig
TPR repeat protein 11, hFis1, FIS1 homolog, CGI-135, CGI 135
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (5) | Immunogen: CatNo: Ag1409 Product name: Recombinant human FIS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC009428 Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009428 |
| Conjugate: Unconjugated | Gene Symbol: FIS1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 51024 |
| Application: Western Blot (WB) | RRID: AB_2881994 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (21257639, 21459773, 23333625) |
Reviews
Write Your Own Review