USP7 Monoclonal antibody proteintech 66514-1-Ig
$449.00
In stock
SKU
66514-1-Ig
Deubiquitinating enzyme 7, HAUSP, TEF1, Ubiquitin thioesterase 7, USP7
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Rat, Mouse And More (1) | Immunogen: CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-93 aa of Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 128 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: 7874 |
| Conjugate: Unconjugated | Gene Symbol: AB_2881877 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): Unconjugated |
| Application: Western Blot (WB) | RRID: Liquid |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Protein A purification |
| Tested Reactivity: Human, Rat, Mouse | Form: Q93009 |
| Host / Isotype: Mouse / IgG2a |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
