LPCAT3 Monoclonal antibody proteintech 67882-1-Ig
$449.00
In stock
SKU
67882-1-Ig
1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoethanolamine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, 1C1G3, C3F
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Pig And More (1) | Immunogen: CatNo: Ag6472 Product name: Recombinant human LPCAT3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 122-233 aa of BC065194 Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC065194 |
| Conjugate: Unconjugated | Gene Symbol: LPCAT3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10162 |
| Application: Western Blot (WB) | RRID: AB_2918639 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Lysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
