ACC1 Monoclonal antibody proteintech 67373-1-Ig
$449.00
In stock
SKU
67373-1-Ig
ACACA, ACC-alpha, ACCA, ACC, ACAC
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag17503 Product name: Recombinant human ACC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2260-2383 aa of BC137287 Sequence: LLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 2383 aa, 275 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC137287 |
| Conjugate: Unconjugated | Gene Symbol: Acetyl-CoA Carboxylase 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 31 |
| Application: Western Blot (WB) | RRID: AB_2882621 |
| Dilution: WB : 1:10000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: ACACA(Acetyl-CoA carboxylase 1, ACC), also named as ACAC, ACC1 and ACCA, belongs to the biotin containing enzyme family. It catalyzes the synthesis of malonyl-CoA, which is an intermediate substrate playing a pivotal role in the regulation of fatty acid metabolism and energy production. ACACA is involved in the biosynthesis of fatty acids, and malonyl-CoA produced is used as a building block to extend the chain length of fatty acids by fatty acid synthase (FAS)(PMID:19900410). It has 4 isoforms produced by alternative promoter usage with the molecular weight between 260 kDa and 270 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
