CD90 Monoclonal antibody proteintech 66766-1-Ig
$449.00
In stock
SKU
66766-1-Ig
CD90 / Thy1, THY1, 2D7D11, Thy 1 antigen, Thy 1 cell surface antigen
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig, Rabbit And More (1) | Immunogen: CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 161 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC065559 |
| Conjugate: Unconjugated | Gene Symbol: CD90/Thy1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7070 |
| Application: Western Blot (WB) | RRID: AB_2882112 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
