TGFBR2 Monoclonal antibody proteintech 66636-1-Ig
$449.00
In stock
SKU
66636-1-Ig
2D5H7, EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag25773 Product name: Recombinant human TGFBR2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-166 aa of BC040499 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 65 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC040499 |
| Conjugate: Unconjugated | Gene Symbol: TGFBR2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7048 |
| Application: Western Blot (WB) | RRID: AB_2881995 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 result in both SMAD4-dependent constraint of proliferation and SMAD4-independent activation of apoptosis (PMID: 29396446). The calculated molecular weight of TGFBR2 is 65 kDa. It has some isoforms with the molecular weight of 70-80 kDa and ~90 kDa after glycosylated. |
Reviews
Write Your Own Review