Neudesin/NENF Monoclonal antibody proteintech 60131-1-Ig
$449.00
In stock
SKU
60131-1-Ig
NENF, Neudesin, 4G9E12, Cell immortalization-related protein 2, Neuron-derived neurotrophic factor
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, pig | Immunogen: CatNo: Ag8387 Product name: Recombinant human NENF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 33-172 aa of BC008823 Sequence: QTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 172 aa, 19 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC008823 |
| Conjugate: Unconjugated | Gene Symbol: NENF |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 29937 |
| Application: Western Blot (WB) | RRID: AB_2150987 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Neudesin neurotrophic factor?(NENF, also known as CIR2, SPUF, and SCIRP10) acts as a neurotrophic factor in postnatal mature neurons enhancing neuronal survival, which is localized to mitochondria and endoplasmic reticulum by PINK1 and PARK7 (PMID: 31536960). NENF in the adult brain is expected to play roles in the maintenance and protection of neurons in an autocrine/paracrine manner (PMID: 15605373). It greatly increases cAMP levels in neural precursor cells and might activate a Gs-protein-coupled receptor that could activate the MAPK, PKA, and PI-3K signal pathways (PMID: 16547973). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
