OCT4/POU5F1 Polyclonal antibody proteintech 11263-1-AP
$449.00
In stock
SKU
11263-1-AP
OCT4, POU5F1, OCT3, Oct-3, Oct-4
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag1794 Product name: Recombinant human OCT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-265 aa of BC020712 Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Predict reactive species |
| Applications: WB, IP, ELISA | Observed Molecular Weight: 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020712 |
| Conjugate: Unconjugated | Gene Symbol: POU5F1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5460 |
| Application: Western Blot (WB) | RRID: AB_2167545 |
| Dilution: WB : 1:1000-1:5000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |