IFITM1-Specific Monoclonal antibody proteintech 60074-1-Ig
$449.00
In stock
SKU
60074-1-Ig
IFITM1, 5B5E2, 9 27, 927, CD225
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000897 |
| Conjugate: Unconjugated | Gene Symbol: IFITM1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8519 |
| Application: Western Blot (WB) | RRID: AB_2233405 |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: IFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3. |
Reviews
Write Your Own Review