DMC1 Monoclonal antibody proteintech 67176-1-Ig
$449.00
In stock
SKU
67176-1-Ig
LIM15, HsLim15, DMC1H, 2D5C9
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag6951 Product name: Recombinant human DMC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-165 aa of BC035658 Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTL Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 165 aa, 18 kDa, 38 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC035658 |
| Conjugate: Unconjugated | Gene Symbol: DMC1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 11144 |
| Application: Western Blot (WB) | RRID: AB_2882472 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
