IL-1 beta Monoclonal antibody proteintech 66737-1-Ig
$449.00
In stock
SKU
66737-1-Ig
2A1B4, Catabolin, IL 1, IL 1 beta, IL1 beta
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA, Cell treatment | Observed Molecular Weight: 269 aa, 31 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC008678 |
| Conjugate: Unconjugated | Gene Symbol: IL1B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3553 |
| Application: Western Blot (WB) | RRID: ENSG00000125538 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: AB_2882087 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Mouse / IgG1 | Background Information: Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form. |