GLUT4 Monoclonal antibody proteintech 66846-1-Ig
$449.00
In stock
SKU
66846-1-Ig
SLC2A4, 3G7C9, Glucose transporter GLUT 4, Glucose transporter type 4, insulin-responsive, GLUT 4
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig And More (2) | Immunogen: CatNo: Ag15390 Product name: Recombinant human GLUT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 228-292 aa of BC069615 Sequence: RYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAV Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 509 aa, 55 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC069615 |
| Conjugate: Unconjugated | Gene Symbol: GLUT4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6517 |
| Application: Western Blot (WB) | RRID: AB_2882186 |
| Dilution: WB : 1:1000-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2b |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
