CD9 Monoclonal antibody proteintech 60232-1-Ig
$449.00
In stock
SKU
60232-1-Ig
CD9 antigen, BTCC 1, BA2, 5H9 antigen, 5H9
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag14529 Product name: Recombinant human CD9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 100-208 aa of BC011988 Sequence: FAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMI Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, ELISA, PLA | Observed Molecular Weight: 228 aa, 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC011988 |
| Conjugate: Unconjugated | Gene Symbol: CD9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 928 |
| Application: Western Blot (WB) | RRID: AB_11232215 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). CD9 is also known as the p24 antigen besides MIC3, TSPAN29 because it is a protein of molecular weight 24 kD. The CD9 antigen appears to be a 227-amino acid molecule with 4 hydrophobic domains and 1 N-glycosylation site. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
