IL-10 Monoclonal antibody proteintech 60269-1-Ig
$449.00
In stock
SKU
60269-1-Ig
IL-10,IL10, 8E4B6, CSIF, IL 10, IL10
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag14870 Product name: Recombinant human IL-10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 19-178 aa of BC104252 Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA, Cell treatment | Observed Molecular Weight: 21 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC104252 |
| Conjugate: Unconjugated | Gene Symbol: IL-10 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3586 |
| Application: Western Blot (WB) | RRID: AB_2881389 |
| Dilution: WB : 1:2000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Interleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
