NLRP3 Monoclonal antibody proteintech 68102-1-Ig
$449.00
In stock
SKU
68102-1-Ig
3H1A7, Angiotensin/vasopressin receptor AII/AVP-like, C1orf7, CIAS1, Cold-induced autoinflammatory syndrome 1 protein
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag26289 Product name: Recombinant human NLRP3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 937-1036 aa of NM_001079821 Sequence: MLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA, Cell treatment | Observed Molecular Weight: 118 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001079821 |
| Conjugate: Unconjugated | Gene Symbol: NLRP3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 114548 |
| Application: Western Blot (WB) | RRID: AB_2923634 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: NALP3, also named as C1orf7, CIAS1 and PYPAF1, belongs to the NLRP family. NLRP3, a key and eponymous component of the NLRP3 inflammasome, plays a crucial role in innate immunity and inflammation. NALP3 may function as an inducer of apoptosis. It interacts selectively with ASC and this complex may function as an upstream activator of NF-kappa-B signaling.NALP3 inhibits TNF-alpha induced activation and nuclear translocation of RELA/NF-KB p65. Also inhibits transcriptional activity of RELA. NALP3 activates caspase-1 in response to a number of triggers including bacterial or viral infection which leads to processing and release of IL1B and IL18. Defects in NLRP3 are the cause of familial cold autoinflammatory syndrome type 1 (FCAS1) which also known as familial cold urticaria. Defects in NLRP3 are a cause of Muckle-Wells syndrome (MWS) which is urticaria-deafness-amyloidosis syndrome. Defects in NLRP3 are the cause of chronic infantile neurologic cutaneous and articular syndrome (CINCA) which also known as neonatal onset multisystem inflammatory disease (NOMID). NLRP3 has some isoforms with the MW of 106-118 kDa and 75-83 kDa(PMID: 17164409, 34680443). |