CD8a Monoclonal antibody proteintech 66868-1-Ig
$449.00
In stock
SKU
66868-1-Ig
CD8, 1G2B10, CD8a molecule, Leu2, MAL
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag11111 Product name: Recombinant human CD8A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 23-183 aa of BC025715 Sequence: QFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGCYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDI Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 235 aa, 26 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC025715 |
| Conjugate: Unconjugated | Gene Symbol: CD8A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 925 |
| Application: Western Blot (WB) | RRID: ENSG00000153563 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: AB_2882205 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Mouse / IgG1 | Background Information: CD8 is a transmembrane glycoprotein that is predominantly expressed on the surface of cytotoxic T cells, and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. This antibody is raised against 23-183 aa of human CD8a, the alpha chain of CD8 molecule. |