ASC/TMS1 Polyclonal antibody proteintech 10500-1-AP
$449.00
In stock
SKU
10500-1-AP
PYCARD, hASC, Caspase recruitment domain-containing protein 5, CARD5, ASC
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag0774 Product name: Recombinant human TMS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC004470 Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC004470 |
| Conjugate: Unconjugated | Gene Symbol: ASC/TMS1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 29108 |
| Application: Western Blot (WB) | RRID: AB_2174862 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9. |
Reviews
Write Your Own Review