SOX2 Polyclonal antibody proteintech 11064-1-AP
$449.00
In stock
SKU
11064-1-AP
ANOP3, MCOPS 3, MCOPS3, SOX 2, Transcription factor SOX 2
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Zebrafish And More (3) | Immunogen: CatNo: Ag1530 Product name: Recombinant human SOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species |
| Applications: WB, IHC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 34 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013923 |
| Conjugate: Unconjugated | Gene Symbol: SOX2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6657 |
| Application: Western Blot (WB) | RRID: AB_2195801 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Zebrafish | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review