CX3CL1 Monoclonal antibody proteintech 60339-1-Ig
$449.00
In stock
SKU
60339-1-Ig
CX3C membrane-anchored chemokine, C3Xkine, C X3 C motif chemokine 1, ABCD 3, A-152E5.2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag0161 Product name: Recombinant human CX3CL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 90-245 aa of BC001163 Sequence: DRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQ Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001163 |
| Conjugate: Unconjugated | Gene Symbol: CX3CL1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6376 |
| Application: Western Blot (WB) | RRID: AB_2881448 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
