AQP5 Polyclonal antibody proteintech 20334-1-AP
$449.00
In stock
SKU
20334-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag14103 Product name: Recombinant human AQP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 265 aa, 28 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032946 |
| Conjugate: Unconjugated | Gene Symbol: AQP5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 362 |
| Application: Western Blot (WB) | RRID: AB_2918066 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: AQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells. |
Reviews
Write Your Own Review