MTCH2 Polyclonal antibody proteintech 16888-1-AP
$449.00
In stock
SKU
16888-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Rat And More (2) | Immunogen: CatNo: Ag10399 Product name: Recombinant human MTCH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-178 aa of BC000875 Sequence: GYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGF Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 303 aa, 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000875 |
| Conjugate: Unconjugated | Gene Symbol: MTCH2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 23788 |
| Application: Western Blot (WB) | RRID: AB_2266733 |
| Dilution: WB : 1:2000-1:14000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
