GLUT1 Polyclonal antibody proteintech 21829-1-AP

$449.00
In stock
SKU
21829-1-AP

 

SLC2A1, GLUT-1, SLC2A1,GLUT1

Host / Isotype: Rabbit / IgG Class: Polyclonal
Reactivity: Human, Mouse, Rat And More (4) Immunogen: CatNo: Ag16282 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species
 Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ChIP, ELISA Observed Molecular Weight: 492 aa, 54 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC121804
Conjugate: Unconjugated Gene Symbol: GLUT1
Tested Applications: Positive WB detected in Gene ID (NCBI): 6513
Application: Western Blot (WB) RRID: AB_10837075
Dilution: WB : 1:1000-1:8000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Rabbit / IgG

 

 

Reviews

Write Your Own Review
You're reviewing:GLUT1 Polyclonal antibody proteintech 21829-1-AP
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.