GLUT1 Polyclonal antibody proteintech 21829-1-AP
$449.00
In stock
SKU
21829-1-AP
SLC2A1, GLUT-1, SLC2A1,GLUT1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (4) | Immunogen: CatNo: Ag16282 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, FC (Intra), ChIP, ELISA | Observed Molecular Weight: 492 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC121804 |
| Conjugate: Unconjugated | Gene Symbol: GLUT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6513 |
| Application: Western Blot (WB) | RRID: AB_10837075 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |