SESN1 Polyclonal antibody proteintech 21668-1-AP
$449.00
In stock
SKU
21668-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag16462 Product name: Recombinant human SESN1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC112036 Sequence: MAEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSDGLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPRPLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLD Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 551 aa, 64 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC112036 |
| Conjugate: Unconjugated | Gene Symbol: SESN1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 27244 |
| Application: Western Blot (WB) | RRID: AB_10793724 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Sestrins, including sestrin-1 (PA26), sestrin-2 (Hi95), and sestrin-3, are 48 to 65 kDa cystein sulfinyl reductases and they modulate peroxide signaling and antioxidant defense. These proteins selectively reduce or repair hyperoxidized forms of typical 2-Cys peroxiredoxins within eukaryotes. Expression of these proteins is regulated by p53, a tumor suppressor protein. Sestrin 1 is implicated in the inhibition of cell growth. It is approximately a 66kDa protein in humans (551 amino acids). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
