RICTOR Polyclonal antibody proteintech 27248-1-AP
$449.00
In stock
SKU
27248-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag25649 Product name: Recombinant human RICTOR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC029608 Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 192 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029608 |
| Conjugate: Unconjugated | Gene Symbol: RICTOR |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 253260 |
| Application: Western Blot (WB) | RRID: AB_2880817 |
| Dilution: WB : 1:1000-1:8000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
